PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_12300-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 274aa    MW: 30262.6 Da    PI: 5.983
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_12300-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-1788133148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T eE++ +++++++lG++ W+tIa++++ gRt++++k+ w+++l
  TRIUR3_12300-P1  88 RGNFTSEEEDAIIQLHAMLGNR-WSTIAARLP-GRTDNEIKNVWHTHL 133
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.8553682IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.0E-126295IPR009057Homeodomain-like
SuperFamilySSF466899.61E-2269139IPR009057Homeodomain-like
PROSITE profilePS5129426.01483137IPR017930Myb domain
SMARTSM007171.4E-1487135IPR001005SANT/Myb domain
PfamPF002492.7E-1588133IPR001005SANT/Myb domain
CDDcd001672.55E-1190133No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2296134IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MRRRMGQRTA LPELVAQKLG TTAEHAQRRS CETDVEEEEG EMREQMDPAG LHPSYSERRA  60
LPKQAGLPRC GKSCRLRWIN YLRPDIKRGN FTSEEEDAII QLHAMLGNRW STIAARLPGR  120
TDNEIKNVWH THLKKRLDSS SSKTSGQAGP KRKAKKPAVV ASALEGPTSK PASSPGHSLS  180
MSPEQSLSTS SATDYSMTSS LENTGSSSSW EEFQIDDSFW SETLGMSVDS SSFGMETSDT  240
FSVDSASPSS SNDEMDFWVT LFMQAGDMQS LSQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-206913940110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9690510.0JN969051.1 Triticum aestivum MYB73 (MYB73) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575391.11e-102PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH45e-69MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLM8AN660.0M8AN66_TRIUA; Myb-related protein Myb4
STRINGMLOC_34646.11e-123(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.14e-50myb domain protein 15